« Zurück
Startseite /
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

ArtNr	GP-029-50
Hersteller	Biosensis
Menge	50ul
Kategorie	Metabolism Glucose Homeostasis Regulation of Appetite Antibodies Obesity Immunohistochemistry Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	IHC
Specific against	Mouse (Murine, Mus musculus)
Host	Guinea Pig
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Agrp, Agrt, Art, Agouti-related protein
Lieferbar
Sub category	Neuroendocrine-Diabetes & Obesity
products_extra_fields_value	AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
products_quantity	200
storage	It is recommended that a thawed sample is stored at 4AC for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20AC or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
purityisotype	Neat serum
formulation	Lyophilised
immunogen	A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
crossreactivity	This antibody is known to react with sheep and rat. Other species have not yet been tested.
conality	Guinea pig
specificity	Specificity was demonstrated by immunohistochemistry.
reconstitution	Reconstitute in 50 Aul sterile water. Centrifuge to remove any insoluble material.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 18.12.2025

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern