« Back
Home /
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

Item no.	GP-029-50
Manufacturer	Biosensis
Amount	50ul
Category	Metabolism Glucose Homeostasis Regulation of Appetite Antibodies Obesity Immunohistochemistry Primary Antibodies
Type	Antibody Polyclonal
Applications	IHC
Specific against	Mouse (Murine, Mus musculus)
Host	Guinea Pig
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Agrp, Agrt, Art, Agouti-related protein
Available
Sub category	Neuroendocrine-Diabetes & Obesity
products_extra_fields_value	AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
products_quantity	200
storage	It is recommended that a thawed sample is stored at 4AC for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20AC or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
purityisotype	Neat serum
formulation	Lyophilised
immunogen	A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
crossreactivity	This antibody is known to react with sheep and rat. Other species have not yet been tested.
conality	Guinea pig
specificity	Specificity was demonstrated by immunohistochemistry.
reconstitution	Reconstitute in 50 Aul sterile water. Centrifuge to remove any insoluble material.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 16 days

Compare

Add to wishlist

Get an offer