« Zurück
Startseite /
Recombinant Human HtrA1, His - tagged

Recombinant Human HtrA1, His - tagged

ArtNr	BTZ-30600102
Hersteller	BioTeZ
Menge	5 ug/25 ul
Kategorie	Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Familie	Member of the trypsin family of serine proteases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Purity	> 70 %
Product Subcategory	EC 3.4.21.108
Pathway and Disease	Diseases associated with HTRA1 include Carasil Syndrome and Cerebral Arteriopathy, Autosomal Dominant, With Subcortical Infarcts And Leukoencephalopathy, 2. Among its related pathways are Degradation of the extracellular matrix.
Description	HtrA1 is a serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF-beta proteins are themselves degraded. By acting on TGF-beta signaling, may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets.
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays
Alternate Names	High-Temperature Requirement A Serine Peptidase 1, Serine Protease 11
Sequence	MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAA GCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGA PEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRA QAGLCVCASSEPVCGSDANTYANLCQLRAASRRSE RLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADV VEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS EDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDV DEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVV AIGSPFSLQNTVTTGIVSTT QRGGKELGLRNSDM DYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTA GISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIG IRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIP DTPAEAGGLKENDVIISINGQSVVSANDVSDVIKR ESTLNMVVRRGNEDIMITVIPEEIDPHHHHHH
Accession No	Q92743
Composition	150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35, 50 mM imidazol, 50 mM Tris-HCl, pH 7.5
Storage	Store at -70C
Target Modification	No
Expression System	Insect Cell
Product Subtype	full length
Active?	Yes
Tag	His-tagged
Gene ID	5654
Molecular Weight	53 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human HtrA1 is expressed in insect cells with a C-terminal His-tag and purified from insect cell culture supernatants
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	HTRA1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug/25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern