« Back
Home /
Recombinant Human HtrA1, His - tagged

Recombinant Human HtrA1, His - tagged

Item no.	BTZ-30600102
Manufacturer	BioTeZ
Amount	5 ug/25 ul
Category	Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Member of the trypsin family of serine proteases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	> 70 %
Product Subcategory	EC 3.4.21.108
Pathway and Disease	Diseases associated with HTRA1 include Carasil Syndrome and Cerebral Arteriopathy, Autosomal Dominant, With Subcortical Infarcts And Leukoencephalopathy, 2. Among its related pathways are Degradation of the extracellular matrix.
Description	HtrA1 is a serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF-beta proteins are themselves degraded. By acting on TGF-beta signaling, may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets.
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays
Alternate Names	High-Temperature Requirement A Serine Peptidase 1, Serine Protease 11
Sequence	MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAA GCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGA PEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRA QAGLCVCASSEPVCGSDANTYANLCQLRAASRRSE RLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADV VEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS EDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDV DEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVV AIGSPFSLQNTVTTGIVSTT QRGGKELGLRNSDM DYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTA GISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIG IRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIP DTPAEAGGLKENDVIISINGQSVVSANDVSDVIKR ESTLNMVVRRGNEDIMITVIPEEIDPHHHHHH
Accession No	Q92743
Composition	150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35, 50 mM imidazol, 50 mM Tris-HCl, pH 7.5
Storage	Store at -70C
Target Modification	No
Expression System	Insect Cell
Product Subtype	full length
Active?	Yes
Tag	His-tagged
Gene ID	5654
Molecular Weight	53 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human HtrA1 is expressed in insect cells with a C-terminal His-tag and purified from insect cell culture supernatants
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	HTRA1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug/25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer