« Zurück
Startseite /
Recombinant Human HtrA3, His - tagged

Recombinant Human HtrA3, His - tagged

ArtNr	BTZ-30600502
Hersteller	BioTeZ
Menge	5 ug/50 ul
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Familie	Member of the trypsin family of serine proteases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Purity	> 70 %
Product Subcategory	EC 3.4.21.108
Pathway and Disease	Diseases associated with HTRA3 include Vitreoretinopathy, Neovascular Inflammatory and Purulent Acute Otitis Media, Preeclampsia
Description	HtrA3 is a serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans (By similarity). May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays
Alternate Names	High-Temperature Requirement Factor A3, Pregnancy-Related Serine Protease
Sequence	MQARALLLAALAALALAREPPAAPCPARCDVSRCP SPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPC GESLECVRGLCRCRWSHAVCGTDGHTYANVCALQA ASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKF NFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSG SGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQ NGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLG HSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE GRELGLRDSDMDYIQTDAIIHHHHHH
Accession No	P83110
Composition	150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35, 50 mM imidazol, 50 mM Tris-HCl, pH 7.5.
Storage	Store at -70C
Target Modification	No
Expression System	Insect Cell
Product Subtype	full length
Active?	Yes
Tag	His-tagged
Gene ID	94031
Molecular Weight	50 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human HtrA3 is expressed in insect cells with a C-terminal His-tag and purified from insect cell culture supernatants
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	HTRA3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug/50 ul

lieferbar

Lieferung vsl. bis 04.12.2025

Express-Lieferung: 23 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern