« Back
Home /
Recombinant Human HtrA3, His - tagged

Recombinant Human HtrA3, His - tagged

Item no.	BTZ-30600502
Manufacturer	BioTeZ
Amount	5 ug/50 ul
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Member of the trypsin family of serine proteases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	> 70 %
Product Subcategory	EC 3.4.21.108
Pathway and Disease	Diseases associated with HTRA3 include Vitreoretinopathy, Neovascular Inflammatory and Purulent Acute Otitis Media, Preeclampsia
Description	HtrA3 is a serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans (By similarity). May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays
Alternate Names	High-Temperature Requirement Factor A3, Pregnancy-Related Serine Protease
Sequence	MQARALLLAALAALALAREPPAAPCPARCDVSRCP SPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPC GESLECVRGLCRCRWSHAVCGTDGHTYANVCALQA ASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKF NFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSG SGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQ NGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLG HSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE GRELGLRDSDMDYIQTDAIIHHHHHH
Accession No	P83110
Composition	150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35, 50 mM imidazol, 50 mM Tris-HCl, pH 7.5.
Storage	Store at -70C
Target Modification	No
Expression System	Insect Cell
Product Subtype	full length
Active?	Yes
Tag	His-tagged
Gene ID	94031
Molecular Weight	50 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human HtrA3 is expressed in insect cells with a C-terminal His-tag and purified from insect cell culture supernatants
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	HTRA3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug/50 ul

available

Delivery expected until 10/2/2025

Express Delivery: Save 24 days

Compare

Add to wishlist

Get an offer