« Zurück
Startseite /
Procathepsin K (CTSK)

Procathepsin K (CTSK)

ArtNr	BTZ-30701002
Hersteller	BioTeZ
Menge	10 ug/50 ul
Kategorie	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Familie	Member of the peptidase C1 protein family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Purity	>95%
Product Subcategory	EC 3.4.22
Pathway and Disease	Diseases associated with CTSK include Pycnodysostosis and Hyperostosis, Endosteal. Among its related pathways are Toll-like receptor signaling pathway and RANK Signaling in Osteoclasts.
Description	CTSK is closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays, Drug target by excessive bone resorption, such as osteoporosis
Alternate Names	CTSK
Sequence	MEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEK NLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVV QKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYR KKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTG KLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKN RGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREI PEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKG VYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS WGENWGNKGYILMARNKNNACGIANLASFPKM
Accession No	P43235
Composition	500 mM NaCl, 25 mM Tris-HCl, pH 8.0
Storage	Store at -70C
Target Modification	No
Expression System	E.coli
Product Subtype	protein fragment
Active?	Yes, after activation (pH adjusting)
Tag	untagged
Gene ID	1513
Molecular Weight	24 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human procathepsin K of amino acids Glu19 - Met215 is expressed in E. coli with an additional M-residue at the N-terminus.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	CTSK

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug/50 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 13 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern