« Back
Home /
Procathepsin K (CTSK)

Procathepsin K (CTSK)

Item no.	BTZ-30701002
Manufacturer	BioTeZ
Amount	10 ug/50 ul
Category	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Protein Family	Member of the peptidase C1 protein family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Purity	>95%
Product Subcategory	EC 3.4.22
Pathway and Disease	Diseases associated with CTSK include Pycnodysostosis and Hyperostosis, Endosteal. Among its related pathways are Toll-like receptor signaling pathway and RANK Signaling in Osteoclasts.
Description	CTSK is closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
Applications Info	Characterization of structure and function, Screening of inhibitors, Standard in enzymatic and immunologiacal assays, Drug target by excessive bone resorption, such as osteoporosis
Alternate Names	CTSK
Sequence	MEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEK NLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVV QKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYR KKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTG KLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKN RGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREI PEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKG VYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS WGENWGNKGYILMARNKNNACGIANLASFPKM
Accession No	P43235
Composition	500 mM NaCl, 25 mM Tris-HCl, pH 8.0
Storage	Store at -70C
Target Modification	No
Expression System	E.coli
Product Subtype	protein fragment
Active?	Yes, after activation (pH adjusting)
Tag	untagged
Gene ID	1513
Molecular Weight	24 kDa
Shipping Temp Min	dry ice
Product description long	Recombinant human procathepsin K of amino acids Glu19 - Met215 is expressed in E. coli with an additional M-residue at the N-terminus.
Purification	Mentioned in the data sheet
Restrictions	For Research Use only.
NCBI Official Symbol	CTSK

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug/50 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer