« Zurück
Startseite /
Recombinant Human Interleukin-1 beta protein (IL1B), partial

Recombinant Human Interleukin-1 beta protein (IL1B), partial

ArtNr	BM-RPC30893-100ug
Hersteller	Biomatik
Menge	100 ug
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	>90% by SDS-PAGE
Sequence	APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Alias	IL-1 beta, Catabolin
Versandbedingung	Gekühlt
Lieferbar
Specificity	Human (Homo sapiens)
Manufacturer - Category	Protein
Manufacturer - Targets	Interleukin-1 beta protein (IL1B)
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 6xHis-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	21.5kDa
Manufacturer - Research Area	Immunology
Protein Length	Partial
Protein Type	Recombinant Protein
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	Not Tested
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Human Interleukin-1 beta protein (IL1B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Interleukin-1 beta protein (IL1B) . Accession Number: P01584; IL1B. Expression Region: 117-269aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 21.5kda. Target Synonyms: IL-1 beta; Catabolin Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Human Interleukin-1 beta protein (IL1B), partial is a purified Recombinant Protein.
Activity	Not Tested

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 14.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern