Comparison

Recombinant Human Interleukin-1 beta protein (IL1B), partial

Item no. BM-RPC30893-100ug
Manufacturer Biomatik
Amount 100 ug
Specific against Human (Homo sapiens)
Host E.coli
Purity >90% by SDS-PAGE
Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Alias IL-1 beta, Catabolin
Shipping Condition Cool pack
Available
Specificity Human (Homo sapiens)
Manufacturer - Category
Protein
Manufacturer - Targets
Interleukin-1 beta protein (IL1B)
Manufacturer - Conjugate / Tag
Unconjugated, C-Terminal 6xHis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)
21.5kDa
Manufacturer - Research Area
Immunology
Protein Length
Partial
Protein Type
Recombinant Protein
Restrictions
For Research Use Only. Not for use in diagnostic procedures.
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Endotoxin
Not Tested
Quality Systems
This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description
Recombinant Human Interleukin-1 beta protein (IL1B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Interleukin-1 beta protein (IL1B) . Accession Number: P01584; IL1B. Expression Region: 117-269aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 21.5kda. Target Synonyms: IL-1 beta; Catabolin Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Human Interleukin-1 beta protein (IL1B), partial is a purified Recombinant Protein.
Activity
Not Tested

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close