« Zurück
Home /
Recombinant Human Folate receptor gamma (FOLR3)

Recombinant Human Folate receptor gamma (FOLR3)

ArtNr	BM-RPC31766-1mg
Hersteller	Biomatik
Menge	1 mg
Specific against	Human (Homo sapiens)
Host	Mammalian cells
Konjugat/Tag	Unconjugated, HIS
Purity	>95% by SDS-PAGE
Sequence	QPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Alias	FR-gamma, Folate receptor 3
Versandbedingung	Gekühlt
Lieferbar
Specificity	Human (Homo sapiens)
Manufacturer - Category	Protein
Manufacturer - Targets	Folate receptor gamma (FOLR3)
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 10xHis-Avi-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	27.0kDa
Manufacturer - Research Area	Otherss
Protein Length	Full Length of Mature Protein
Protein Type	Recombinant Protein
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	Not Tested
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Human Folate receptor gamma (FOLR3) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Folate receptor gamma (FOLR3) . Accession Number: P41439; FOLR3. Expression Region: 23-245aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 27.0kda. Target Synonyms: FR-gamma; Folate receptor 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Human Folate receptor gamma (FOLR3) is a purified Recombinant Protein.
Activity	Not Tested

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 12.06.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail