« Back
Home /
Recombinant Human Folate receptor gamma (FOLR3)

Recombinant Human Folate receptor gamma (FOLR3)

Item no.	BM-RPC31766-1mg
Manufacturer	Biomatik
Amount	1 mg
Specific against	Human (Homo sapiens)
Host	Mammalian cells
Conjugate/Tag	Unconjugated, HIS
Purity	>95% by SDS-PAGE
Sequence	QPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Alias	FR-gamma, Folate receptor 3
Shipping condition	Cool pack
Available
Specificity	Human (Homo sapiens)
Manufacturer - Category	Protein
Manufacturer - Targets	Folate receptor gamma (FOLR3)
Manufacturer - Conjugate / Tag	Unconjugated, C-Terminal 10xHis-Avi-Tagged
Shipping Temperature	Ice packs
Storage Conditions	-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)	27.0kDa
Manufacturer - Research Area	Otherss
Protein Length	Full Length of Mature Protein
Protein Type	Recombinant Protein
Restrictions	For Research Use Only. Not for use in diagnostic procedures.
Reconstitution	Refer to the datasheet/CoA included in the product pouch.
Endotoxin	Not Tested
Quality Systems	This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee	This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description	Recombinant Human Folate receptor gamma (FOLR3) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Folate receptor gamma (FOLR3) . Accession Number: P41439; FOLR3. Expression Region: 23-245aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 27.0kda. Target Synonyms: FR-gamma; Folate receptor 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description	Recombinant Human Folate receptor gamma (FOLR3) is a purified Recombinant Protein.
Activity	Not Tested

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 6/12/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail