Vergleich

Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF Europäischer Partner

ArtNr BOS-PROTA0A287BGK8-5ug
Hersteller Boster
Menge 5 ug
Quantity options 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Pig (Porcine, Sus scrofa domesticus)
Konjugat/Tag HIS
Sequence AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.
Alias Fgfb,bFGF,FGF-basic
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 18.1 kDa.
The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 18.1 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
FGF2
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.
Bioactivity/Biological Activity
Measure by its ability to induce proliferation in 3T3 cells.
The ED₅₀ for this effect is <2 ng/mL.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 04.12.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen