« Zurück
Startseite /
Mouse recombinant CD27L (CD27 ligand) protein, AF

Mouse recombinant CD27L (CD27 ligand) protein, AF

ArtNr	BOS-PROTO55237-20ug
Hersteller	Boster
Menge	20 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Oncology By Cell Type Carcinoma Hematology Lymphoma Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Konjugat/Tag	HIS
Sequence	QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus.
Alias	soluble CD27 Ligand,sCD27 Ligand,TNFSF7,CD70,Tnfs,Tnlg8a
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 17.25 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 17.25 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	CD70
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	CD27L is also named for CD70 which is one member of TNF family. CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. CD27L is a 19.2 kDa cytokine with 148 amino acid residues which is a transmembrane glycoprotein. CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy.
Bioactivity/Biological Activity	Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <4.5 μg/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTO55237-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 04.12.2025