« Zurück
Startseite /
Human recombinant IL-33 (Interleukin-33) protein, AF

Human recombinant IL-33 (Interleukin-33) protein, AF

ArtNr	BOS-PROTO95760-4-5ug
Hersteller	Boster
Menge	5 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Cell Biology Cell Culture Cytokines Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Sequence	MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET with polyhistidine tag at the C-terminus.
Alias	IL-1 F11,NF-HEV,DVS27
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 18.93 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 18.93 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IL33
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Interleukin 33 (IL-33) is an 18 kDa cytokine with 169 amino acid residues. Interleukin-33 is a member of the IL-1 cytokine family and is primarily expressed in endothelial cells, epithelial cells, fibroblasts, and mesenchymal cells. When IL-33 binds to its receptor, ST2L, it activates mast cells and innate lymphoid cells and subsequently generates IL-5 and IL-13, which play essential roles in allergic inflammation. IL-33 also acts as an alarm by alerting the immune system of cellular damage and plays a critical role in type-2 innate immunity.
Bioactivity/Biological Activity	Measure by its ability to binding with recombinant ST2L (IL-33 receptor). The ED₅₀ for this effect is <54 ng/mL. Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is < 0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x10⁷ IU/ mg.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTO95760-4-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 04.12.2025