« Zurück
Startseite /
Human recombinant IFN alpha 1a (Interferon alpha 1a) protein, AF

Human recombinant IFN alpha 1a (Interferon alpha 1a) protein, AF

ArtNr	BOS-PROTP01562-2
Hersteller	Boster
Menge	100 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Sequence	CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE with polyhistidine tag at the N-terminus.
Alias	Leukocyte Interferon,IFNA2,B cell Interferon,Type I Interferon
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 20.19 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 20.19 kDa.The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IFNA1
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Interferon-alpha 1a (IFN-alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 19.5kDa protein containing 167 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
Bioactivity/Biological Activity	Measure by its ability to inhibit IL-8 secretion in human PBMCs in the presence of LPS. The ED₅₀ for this effect is <1.12 μg /mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTP01562-2-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.12.2025