« Zurück
Startseite /
Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

Mouse recombinant CCL4 (C-C Motif Chemokine Ligand 4) protein, AF

ArtNr	BOS-PROTP14097-2
Hersteller	Boster
Menge	100 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Neuroscience Neuroinflammation Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Konjugat/Tag	HIS
Sequence	APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus.
Alias	MIP-1b: Macrophage Inflammatory Protein-1β,ACT-2
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 8.64 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 8.64 kDa.The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	CCL4
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNγ, and production of TNF when CCL4 binds to CCR5.
Bioactivity/Biological Activity	Measure by its ability to chemoattract human PBMCs using a concentration range of 20.0 - 200.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTP14097-2-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.12.2025