Vergleich

Human (mammalian cell expression) recombinant HMGB2 protein, AF Europäischer Partner

ArtNr BOS-PROTP26583-3-5ug
Hersteller Boster
Menge 5 ug
Quantity options 100 ug 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Human (Homo sapiens)
Konjugat/Tag SUMO, HIS
Sequence MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine-SUMO tag at the N-terminus
Alias HMG2
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His-SUMO Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 35.57 kDa.
The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 35.57 kDa.The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
HMGB2
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
High Mobility Group protein B2, also known as HMGB2, is a member of the non-histone chromosomal high-mobility group protein family. HMGB2 is expressed 25 kDa containing 209 amino acid residues. The function of HMGB2 is involved in transcription, chromatin remodeling and V(D)J recombination. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles.
Bioactivity/Biological Activity
Testing in process
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 03.02.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen