Vergleich

Human recombinant IL-12 p35 (Interleukin-12 p35) protein, AF Europäischer Partner

ArtNr BOS-PROTP29459-3-5ug
Hersteller Boster
Menge 5 ug
Quantity options 100 ug 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Sequence MRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS with polyhistidine tag at the C-terminus.
Alias Interleukin-12 subunit alpha,IL-12 subunit p35,IL-12A,Cytotoxic Lymphocyte Maturation Factor 35 kDa
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 23.48 kDa.
The protein migrates as 28 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 23.48 kDa.The protein migrates as 28 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
IL12A
Purification
>95% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Interleukin 12 (IL-12) is a pro-inflammatory cytokine with a molecular weight of 70 kDa composed of two subunits, IL-12p35 (35 kDa) and IL-12p40 (40 kDa), and IL-12p35 as a p35-p35 homodimer with 57?kDa molecular weight and a p35 monomer of 27?kDa molecular weight. The p35 molecule is unique to IL-12, while p40 is shared by both IL-12 and IL-23. IL-12 promotes Th1 T cell responses, while IL-23 promotes Th17 T cell responses.
Bioactivity/Biological Activity
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC).
The ED₅₀ for this effect is <49 pg/mL.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen