Vergleich

Mouse recombinant IL-15 (Interleukin-15) protein, AF Europäischer Partner

ArtNr BOS-PROTP48346-4-5ug
Hersteller Boster
Menge 5 ug
Quantity options 100 ug 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Mouse (Murine, Mus musculus)
Konjugat/Tag HIS
Sequence NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS with polyhistidine tag at the N-terminus.
Alias IL-T
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 14.2 kDa.
The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution of Proleukin buffer, pH 7.5.containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 14.2 kDa.The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
Il15
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.
Bioactivity/Biological Activity
Measure by its ability to induce CTLL-2 cells proliferation.
The ED₅₀ for this effect is <10 ng/mL.
The specific activity of recombinant mouse IL-15 is approximately >1x 10⁵ IU/mg.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen