« Zurück
Startseite /
Mouse recombinant IL-38 (Interleukin-38) protein, AF

Mouse recombinant IL-38 (Interleukin-38) protein, AF

ArtNr	BOS-PROTQ8R459-5ug
Hersteller	Boster
Menge	5 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Konjugat/Tag	HIS
Sequence	MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR with polyhistidine tag at the C-terminus.
Alias	interleukin 1 family,member 10,IL1F10
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 17.89 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 17.89 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	Il1f10
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Interleukin 38 (IL-38) is a 16.87 kDa cytokine with 152 amino acid residues and a member of the interleukin-1 (IL-1) family. IL-38 is primarily secreted from basal epithelia of the skin and B cells of the tonsil, spleen, and thymus. It plays essential roles in inflammation and host defense by mediating NF-κB, AP1, and JNK signaling pathways when IL-38 binds to the receptors like IL1RAPL1 and IL-36R. In addition, IL-38 participates in down-regulating cell proliferation, migration, and up-regulating IL-6 and IL-10.
Bioactivity/Biological Activity	Testing in process
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTQ8R459-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 04.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern