Vergleich

Human recombinant Galectin-12 protein, AF Europäischer Partner

ArtNr BOS-PROTQ96DT0-2-5ug
Hersteller Boster
Menge 5 ug
Quantity options 100 ug 20 ug 5 ug
Kategorie
Format Lyophilized
Applikationen Cell Culture
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Sequence SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRA
Alias LGALS12,GAL12,GRIP1
Lieferbar
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 38.4 kDa.
The protein migrates as 38 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 38.4 kDa.The protein migrates as 38 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
LGALS12
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Galectin-12 (Gal-12) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for β-galactoside binding and is required to interact with the VPS13C protein. It has been reported that galectin-12 is presented in the adipose tissue but also expressed in macrophages and other leukocytes. Galectin-12 participates in many biological activities including cell cycle regulation, apoptosis, and cell differentiation. Moreover, galectin-12 has emerged as a crucial factor in driving the macrophage to M1 polarization, leading to inflammation and reducing insulin sensitivity in adipocytes.
Bioactivity/Biological Activity
Testing in process
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen