« Zurück
Startseite /
Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF

Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF

ArtNr	BOS-PROTQ9NSA1-4-5ug
Hersteller	Boster
Menge	5 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Neural Signaling By Cell Type Carcinoma Hematology Myeloma Cell Biology Obesity Cell Culture Cytokines Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Sequence	MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus.
Alias	FGFL
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 20.35 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 20.35 kDa.The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	FGF21
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Fibroblast Growth Factors-21 (FGF-21) is a 22.3 kDa member of the fibroblast Growth Factors with 209 amino acid residues. FGF-21 is expressed from liver and cardiomyocytes. FGF-21 is a key protein that regulates important metabolic pathways, and modulates cellular function, metabolism, and senescence. It can stimulate glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1 /GLUT1 expression.
Bioactivity/Biological Activity	Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED₅₀ for this effect is <0.4 μg/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTQ9NSA1-4-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 04.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern