« Zurück
Startseite /
Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

ArtNr	BOS-PROTQ9QYY1-2
Hersteller	Boster
Menge	100 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Neuroscience Neural Lineage Markers Glial Cell Markers Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Konjugat/Tag	HIS
Sequence	MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus.
Alias	FIL1 delta,IL-1F5,IL-1HY1,IL-1L1,IL-1RP3,IL-1ra Homolog 1,IL-1 delta
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 17.81 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 17.81 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IL36RN
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Interleukin 36 receptor antagonist (IL-36RA) is a 17.21 kDa cytokine with 155 amino acid residues and a member of the IL-36 family. It is mainly secreted from the stomach, lungs, and kidneys. IL-36RA binds to the interleukin-36 receptor and plays a critical role in the anti-inflammatory effect by mediating MAPK and NF-κB signaling pathways. IL-36RA inhibits proinflammatory effect via suppressing production of IL-6, IL-17, and interferon-gamma and promoting production of IL-4.
Bioactivity/Biological Activity	Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTQ9QYY1-2-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern