Vergleich

Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody Europäischer Partner

ArtNr BOS-M01972
Hersteller Boster
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, IHC
Clon 2F6
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a Kappa
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Mitogen-activated protein kinase kinase kinase 1;2.7.11.25;MAPK/ERK kinase kinase 1;MEK kinase 1;MEKK 1;MAP3K1;MAPKKK1, MEKK, MEKK1;
Lieferbar
Manufacturer - Category
Primary Antibodies, Monoclonal Antibodies, 2279
Storage Conditions
Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Observed Molecular Weight
164470 MW
Clonality
Monoclonal
Application Details
Western Blot (1-2ug/ml)
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.
Manufacturer - Gene Name
MAP3K1
Gene Full Name
Mitogen-activated protein kinase kinase kinase 1
Background
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Immunogen
Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Contents
Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Purification
200ug/ml of antibody purified from Bioreactor Concentrate by Protein A/G.
Concentration
Purified antibody with BSA and azide at 200ug/ml
Manufacturer - Research Category
MAPK Pathway, Protein Phosphorylation, Ser/Thr Kinases, Signal Transduction
Protein Function
Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
Subcellular Localization
Cytoplasmic
Short Description
Boster Bio Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody (Catalog # M01972). Tested in WB, IHC applications. This antibody reacts with Human.
Description
Boster Bio Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody (Catalog # M01972). Tested in WB, IHC applications. This antibody reacts with Human.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?