Comparison

Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody European Partner

Item no. BOS-M01972
Manufacturer Boster
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, IHC
Clone 2F6
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a Kappa
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Mitogen-activated protein kinase kinase kinase 1;2.7.11.25;MAPK/ERK kinase kinase 1;MEK kinase 1;MEKK 1;MAP3K1;MAPKKK1, MEKK, MEKK1;
Available
Manufacturer - Category
Primary Antibodies, Monoclonal Antibodies, 2279
Storage Conditions
Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Observed Molecular Weight
164470 MW
Clonality
Monoclonal
Application Details
Western Blot (1-2ug/ml)
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.
Manufacturer - Gene Name
MAP3K1
Gene Full Name
Mitogen-activated protein kinase kinase kinase 1
Background
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Immunogen
Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Contents
Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Purification
200ug/ml of antibody purified from Bioreactor Concentrate by Protein A/G.
Concentration
Purified antibody with BSA and azide at 200ug/ml
Manufacturer - Research Category
MAPK Pathway, Protein Phosphorylation, Ser/Thr Kinases, Signal Transduction
Protein Function
Component of a protein kinase signal transduction cascade. Activates the ERK and JNK kinase pathways by phosphorylation of MAP2K1 and MAP2K4. Activates CHUK and IKBKB, the central protein kinases of the NF-kappa-B pathway.
Subcellular Localization
Cytoplasmic
Short Description
Boster Bio Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody (Catalog # M01972). Tested in WB, IHC applications. This antibody reacts with Human.
Description
Boster Bio Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody (Catalog # M01972). Tested in WB, IHC applications. This antibody reacts with Human.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?