Vergleich

Anti-CD18/ITGB2 Antibody Europäischer Partner

ArtNr BOS-PA1124
Hersteller Boster
Menge 100 ug/vial
Kategorie
Typ Antibody Polyclonal
Format Lyophilized
Applikationen WB, IHC
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias 95 subunit beta antibody, CD 18 antibody, CD18 antibody, Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor) antibody, Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta antibody, Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody, Complement receptor C3 beta subunit antibody, Complement receptor C3 subunit beta antibody, Integrin beta 2 antibody, Integrin beta chain beta 2 antibody, Integrin beta-2 antibody, Integrin, beta 2(complement component 3 receptor 3 and 4 subunit) antibody, ITB2_HUMAN antibody, ITGB2 antibody, LAD antibody, LCAMB antibody, Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C antibody, Leukocyte cell adhesion molecule CD18 antibody, LFA 1 antibody, LFA1 antibody, Lymphocyte function associated antigen 1 antibody, MAC 1 antibody, MAC1 antibody, MF17 antibody, MFI7 antibody, OTTHUMP00000115278 antibody, OTTHUMP00000115279 antibody, OTTHUMP00000115280 antibody, OTTHUMP00000115281 antibody, OTTHUMP00000115282 antibody
Similar products Integrin, Cell surface adhesion glycoprotein LFA 1/CR3/P150, Cell surface adhesion glycoproteins LFA 1/CR3/p150, Leukocyte associated antigens CD18/11A, CD18/11B, 95 subunit beta antibody, CD 18 antibody, CD18 antibody, 959 beta subunit precursor) antibody, Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody, Complement receptor C3 beta subunit antibody, Complement receptor C3 subunit beta antibody, Integrin beta 2 antibody, Integrin beta chain beta 2 antibody, Integrin beta-2 antibody, beta 2(complement component 3 receptor 3 and 4 subunit) antibody, ITB2_HUMAN antibody, ITGB2 antibody, LAD antibody, LCAMB antibody, CD18/11C antibody, Leukocyte cell adhesion molecule CD18 antibody, LFA 1 antibody, LFA1 antibody, Lymphocyte function associated antigen 1 antibody, MAC 1 antibody, MAC1 antibody, MF17 antibody, MFI7 antibody, OTTHUMP00000115278 antibody, OTTHUMP00000115279 antibody, OTTHUMP00000115280 antibody, OTTHUMP00000115281 antibody, OTTHUMP00000115282 antibody
Lieferbar
Storage Conditions
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Molecular Weight
84782 MW
Manufacturer - Gene Name
ITGB2
Gene Full Name
Integrin beta-2
Background
The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the €œinside-out€ signaling pathways.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Contents
Each vial contains 5 mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg NaN3.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Concentration
Add 0.2 ml of distilled water will yield a concentration of 500ug/ml.
Manufacturer - Research Category
|signal transduction|cytoskeleton / ecm|cell adhesion|integrins| signal transduction| immunology|cell type markers| stem cells|hematopoietic progenitors|myeloid|dendritic cell lineage
Protein Name
Integrin beta-2
Protein Function
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.
Sequence Similarities
Belongs to the integrin beta chain family.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug/vial
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?