Vergleich

Mouse IL-6 Recombinant Protein Europäischer Partner

ArtNr BOS-R00102-6
Hersteller Boster
Menge 5 ug
Kategorie
Typ Proteins
Format Lyophilized
Applikationen Cell Culture
Specific against other
Dry ice Yes
Sequence FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-6; IL-6; B-cell hybridoma growth factor; Interleukin HP-1; Il6; Il-6
Lieferbar
Manufacturer - Category
Recombinant Proteins
Storage Conditions
Store at -20°C for one year. Avoid repeated freeze-thaw cycles.
Manufacturer - Gene Name
IL6
Contents
Lyophilized without carrier protein.
Purification
Ion-exchange chromatography.
Manufacturer - Research Category
Angiogenesis, Cancer, Cytokines, Immunology, Innate Immunity, Interleukins, Invasion/Microenvironment, Metabolism, Neurology Process, Neuroscience, Obesity, Tumor Immunology
Protein Function
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Subcellular Localization
Secreted.
Short Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Bioactivity/Biological Activity
In testing.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?