Comparison

Mouse IL-6 Recombinant Protein European Partner

Item no. BOS-R00102-6
Manufacturer Boster
Amount 5 ug
Category
Type Proteins
Format Lyophilized
Applications Cell Culture
Specific against other
Dry ice Yes
Sequence FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT (187)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-6; IL-6; B-cell hybridoma growth factor; Interleukin HP-1; Il6; Il-6
Available
Manufacturer - Category
Recombinant Proteins
Storage Conditions
Store at -20°C for one year. Avoid repeated freeze-thaw cycles.
Manufacturer - Gene Name
IL6
Contents
Lyophilized without carrier protein.
Purification
Ion-exchange chromatography.
Manufacturer - Research Category
Angiogenesis, Cancer, Cytokines, Immunology, Innate Immunity, Interleukins, Invasion/Microenvironment, Metabolism, Neurology Process, Neuroscience, Obesity, Tumor Immunology
Protein Function
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Subcellular Localization
Secreted.
Short Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Description
Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Mouse IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Bioactivity/Biological Activity
In testing.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
Recently viewed