Vergleich

Recombinant Lassa virus Nucleoprotein(N)

ArtNr CSB-EP318401LNP-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Mouse (Murine, Mus musculus)
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDA QALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDL NQAVNNLVELKSTQQKSILRVGTLTSDDLLILAAD LEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRAL LNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQ FGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYT AKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYN FSL
Protein Familie Arenaviridae nucleocapsid protein family
Citations Nucleotide sequence of the Lassa virus (Josiah strain) S genome RNA and amino acid sequence comparison of the N and GPC proteins to other arenaviruses.Auperin D.D., McCormick J.B.Virology 168:421-425(1989)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nucleocapsid protein; Protein N
Lieferbar
Manufacturer - Targets
N
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
79 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Microbiology
Relevance
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity).
Biologically Active
Not Test
Expression Region
1-569aa
Protein Length
Full Length
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity).
Subcellular Location
Virion, Host cytoplasm

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen