« Zurück
Startseite /
Recombinant Lassa virus Nucleoprotein(N)

Recombinant Lassa virus Nucleoprotein(N)

ArtNr	CSB-EP318401LNP-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDA QALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDL NQAVNNLVELKSTQQKSILRVGTLTSDDLLILAAD LEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRAL LNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQ FGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYT AKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYN FSL
Protein Familie	Arenaviridae nucleocapsid protein family
Citations	"Nucleotide sequence of the Lassa virus (Josiah strain) S genome RNA and amino acid sequence comparison of the N and GPC proteins to other arenaviruses."Auperin D.D., McCormick J.B.Virology 168:421-425(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nucleocapsid protein; Protein N
Lieferbar
Manufacturer - Targets	N
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	79 kDa
General Research Areas	Microbiology
Relevance	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity).
Expression Region	1-569aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Disables the host innate defense by interfering with beta interferon (IFNB) production through the inhibition of host IRF3 phosphorylation and activation by host IKBKE. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of IRF3, a protein involved in IFN activation pathway, leading to the inhibition of IFNB and IRF3-dependent promoters activation (By similarity).
Subcellular Location	Virion, Host cytoplasm
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP318401LNP-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern