Vergleich

Recombinant Human CXCL5/ENA78

ArtNr CS-CRE300C
Hersteller Cell Sciences
Menge 1.0 mg
Kategorie
Typ Proteins
Specific against Human (Homo sapiens)
Host E.coli
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products ENA-78, small inducible cytokine subfamily B (Cys-X-Cys), SCYB5, epithelial-derived neutrophil activating protein 78, epithelial-derived neutrophil-activating peptide 78, neutrophil-activating peptide ENA-78, neutrophil-activating protein 78, small inducible cytokine B5, member 5 (epithelial-derived neutrophil-activating peptide 78)
Lieferbar
Manufacturer - Category
Biomolecules
Storage Conditions
This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -80C. Avoid repeated freeze/thaw cycles.
Molecular Weight
8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
Description
Human ENA-78/CXCL5(5-78a.a.) Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-80 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-80 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.
Formulation
Lyophilized from a 0.2um filtered concentrated (1.0 mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.
Reconstitution
Centrifuge vial prior to opening. We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Biological Activity
Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml.
Endotoxin Level
Less than 1EU/ug of rHuENA-78/CXCL5 as determined by LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1.0 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen