Recombinant Human CXCL9/MIG

Kein Verkauf an Patienten, Ärzte, Apotheken oder Privatpersonen! Mehr erfahren

Hersteller Cell Sciences
Kategorie
Typ Proteins
Specific against Human
Menge 1.0 mg
Host E.coli
ArtNr CS-CRMX00C
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Description
Recombinant Human MIG (monokine induced by gamma-interferon ) produced in, E. coli, is a single, non-glycosylated, polypeptide chain containing 103 amino acids.
Formulation
Lyophilized from a sterile filtered solution in 20 mM PB, pH 7.4 + 50 mM NaCl.
Reconstitution
Centrifuge vial prior to opening. Add sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
Storage and Stability
Stable at 2-8C, but best kept desiccated -20C. Upon reconstitution, stable for up to 1 week at 2-8C. For longer term, store in working aliquots below -20C. Avoid repeated freeze/thaw cycles.
Source
E. coli
Molecular Weight
11.7 kDa
Purity
>97% by SDS-PAGE and HPLC
Endotoxin Level
<0.1 ng per ug (1 EU/ug).
Biological Activity
Determined by the dose dependent chemotaxis with human peripferal blood T lymphocytes. ED50 range = 10.0-100.0 ng/mL
AA Sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 1.0 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen