« Zurück
Home /
Recombinant Human CXCL9/MIG

Recombinant Human CXCL9/MIG

ArtNr	CS-CRMX00C
Hersteller	Cell Sciences
Menge	1.0 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	>97% by SDS-PAGE and HPLC
Sequence	TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	MIG, CMK, SCYB9, Humig, crg-10, monokine induced by gamma interferon, small inducible cytokine B9
Lieferbar
Manufacturer - Category	Biomolecules
Storage Conditions	Stable at 2-8C, but best kept desiccated -20C. Upon reconstitution, stable for up to 1 week at 2-8C. For longer term, store in working aliquots below -20C. Avoid repeated freeze/thaw cycles.
Molecular Weight	11.7 kDa
Description	Recombinant Human MIG (monokine induced by gamma-interferon ) produced in, E. coli, is a single, non-glycosylated, polypeptide chain containing 103 amino acids.
Formulation	Lyophilized from a sterile filtered solution in 20 mM PB, pH 7.4 + 50 mM NaCl.
Reconstitution	Centrifuge vial prior to opening. Add sterile distilled water or aqueous buffer to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
Biological Activity	Determined by the dose dependent chemotaxis with human peripferal blood T lymphocytes. ED50 range = 10.0-100.0 ng/mL
Endotoxin Level	<0.1 ng per ug (1 EU/ug).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CS-CRMX00C-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1.0 mg

lieferbar

Lieferung vsl. bis 17.07.2025

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern