« Zurück
Startseite /
Recombinant Human PRK2/PKN2 GST *di

Recombinant Human PRK2/PKN2 GST *di

ArtNr	CS-CSI13455
Hersteller	Cell Sciences
Menge	10 ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Human (Homo sapiens)
Host	Insect
Konjugat/Tag	GST
Purity	80% as determined by a Coomassie blue-stained SDS-PAGE gel.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	PAK2, PRK2, MGC150606, MGC71074, PRKCL2, PRO2042, Pak-2, cardiolipin-activated protein kinase Pak2, protein kinase C-like 2, OTTHUMP00000011760
Lieferbar
Storage Conditions	Store at -80C. At first use, aliquot and store at -80C to avoid multiple freeze-thaws. If properly stored at -80C, this product is guaranteed for 6 months from date of purchase.
Molecular Weight	141.5 kDa
Description	Recombinant Human full-length protein, GST-tagged, additional C-terminal amino acids KGGRADPAFLYKVVMPWIRNSKAYVDELN. No special measures were taken to activate this kinase.
Formulation	Liquid in a buffer of 50 mM Tris, pH 7.5 + 150 mM NaCl + 0.5 mM EDTA + 0.02% Triton X-100 + 2 mM DTT + 50% Glycerol.
Specificity	18 nmole of phosphate transferred to MAPKAPK2 peptide substrate (KKLNRTLSVA) per minute per mg of total protein at 30C. Activity determined at a final protein concentration of 16.7 ug/ml.
Endotoxin Level	<0.1 ng/ug of protein.
Concentration	0.29 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CS-CSI13455-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 22.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern