« Back
Home /
Recombinant Human PRK2/PKN2 GST *di

Recombinant Human PRK2/PKN2 GST *di

Item no.	CS-CSI13455
Manufacturer	Cell Sciences
Amount	10 ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human (Homo sapiens)
Host	Insect
Conjugate/Tag	GST
Purity	80% as determined by a Coomassie blue-stained SDS-PAGE gel.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	PAK2, PRK2, MGC150606, MGC71074, PRKCL2, PRO2042, Pak-2, cardiolipin-activated protein kinase Pak2, protein kinase C-like 2, OTTHUMP00000011760
Available
Storage Conditions	Store at -80C. At first use, aliquot and store at -80C to avoid multiple freeze-thaws. If properly stored at -80C, this product is guaranteed for 6 months from date of purchase.
Molecular Weight	141.5 kDa
Description	Recombinant Human full-length protein, GST-tagged, additional C-terminal amino acids KGGRADPAFLYKVVMPWIRNSKAYVDELN. No special measures were taken to activate this kinase.
Formulation	Liquid in a buffer of 50 mM Tris, pH 7.5 + 150 mM NaCl + 0.5 mM EDTA + 0.02% Triton X-100 + 2 mM DTT + 50% Glycerol.
Specificity	18 nmole of phosphate transferred to MAPKAPK2 peptide substrate (KKLNRTLSVA) per minute per mg of total protein at 30C. Activity determined at a final protein concentration of 16.7 ug/ml.
Endotoxin Level	<0.1 ng/ug of protein.
Concentration	0.29 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CS-CSI13455-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 1/22/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer