Recombinant Human pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108)

Store lyophilized product at 2–8oC. After reconstitution, store at -20°C. Avoidmultiple freeze/thaw cycles.

RecombinantHuman pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108). Molecularweight 12, 183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM(underlined amino acids were added during production and differ from theoriginal sequence).

Purified, Lyophilized. Reconstitute in 10ul double distilled water.

1mg/ml (OD280nm, E0.1%= 0.59) (prior to lyophilization)

NPPBnatriuretic peptide B [ Homo sapiens ]

NP_002512

MicroRNAs incardiomyocyte hypertrophy

Brainnatriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP)or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of theheart in response to excessive stretching of heart muscle cells(cardiomyocytes). BNP is named as such because it was originally identified inextracts of porcine brain, although in humans it is produced mainly in thecardiac ventricles. BNP is co-secreted along with a 76 amino acid N-terminalfragment (NT-proBNP) which is biologically inactive. BNP binds to andactivates the atrial natriuretic factor receptors NPRA, and to a lesserextent NPRB, in a fashion similar to atrial natriuretic peptide (ANP) butwith 10-fold lower affinity. The biological half-life of BNP, however, istwice as long as that of ANP, and that of NT-proBNP is even longer, makingthese peptides better targets than ANP for diagnostic blood testing.