Comparison

Recombinant Human pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108)

Item no. DAG272
Manufacturer Creative Diagnostics
Amount 10 ug
Category
Type Peptides
Format Lyophilized
Specific against other
Purity >95% pure(SDS-PAGE)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias BNP,natriureticpeptides B,OTTHUMP00000002506,natriuretic protein,brain type natriureticpeptide,gamma-brain natriuretic peptide,natriuretic peptide precursor B
Available
Manufacturer - Applications
Specificmethodologies have not been tested using this product.
Storage Conditions
Store lyophilized product at 2–8oC. After reconstitution, store at -20°C. Avoidmultiple freeze/thaw cycles.
Full name
Natriuretic Peptide B
Product Overview
RecombinantHuman pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108). Molecularweight 12, 183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM(underlined amino acids were added during production and differ from theoriginal sequence).
Abbr
NPPB, 1-108 (Human)
Manufacturer - Format
Purified, Lyophilized. Reconstitute in 10ul double distilled water.
Buffer
Lyophilizedfrom 200mM Ammonium acetate, pH 7.0
Concentration
1mg/ml (OD280nm, E0.1%= 0.59) (prior to lyophilization)
Preservative
None
Gene Information - Gene Name
NPPBnatriuretic peptide B [ Homo sapiens ]
Gene Information - mRNA Refseq
NM_002521
Gene Information - Protein Refseq
NP_002512
Gene Information - MIM
600295
Gene Information - Pathway
MicroRNAs incardiomyocyte hypertrophy
Gene Information - Function
diuretic hormoneactivity, hormone activity, peptide hormone receptor binding, receptorbinding
Antigen Description
Brainnatriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP)or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of theheart in response to excessive stretching of heart muscle cells(cardiomyocytes). BNP is named as such because it was originally identified inextracts of porcine brain, although in humans it is produced mainly in thecardiac ventricles. BNP is co-secreted along with a 76 amino acid N-terminalfragment (NT-proBNP) which is biologically inactive. BNP binds to andactivates the atrial natriuretic factor receptors NPRA, and to a lesserextent NPRB, in a fashion similar to atrial natriuretic peptide (ANP) butwith 10-fold lower affinity. The biological half-life of BNP, however, istwice as long as that of ANP, and that of NT-proBNP is even longer, makingthese peptides better targets than ANP for diagnostic blood testing.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close