Vergleich

Recombinant Monkeypox virus Probable host range protein 2(D10L)

ArtNr CSB-MP837688MHV-1mg
Hersteller Cusabio
Menge 1 mg
Quantity options 100 ug 1 mg 20 ug
Kategorie
Typ Viral Antigens
Specific against Virus, Monkeypox
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MGIQHEFDIIINGDIALRNLQLHRGDNYGCKLKIISNDYKKLKLRFVIRPDWSEIDEVKGLTVFANNYAVKVNKVDYTLYYVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKIKEENYSSPYIEHPLIPYRDYESMD
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352202
Alias (D10L,Probable host range protein 2)
Lieferbar
Specificity Monkeypox virus (strain Zaire-96-I-16) (MPX)
Manufacturer - Category
Monkexpox Virus related Proteins
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expression Region
1-150aa
Protein Length
Full Length
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Gene Names
D10L
Activity
Not Test
Endotoxin
Not test.
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen