Vergleich

Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active)

ArtNr CSB-AP004281HU-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Solid
Specific against Human (Homo sapiens)
Konjugat/Tag Fc
Purity Greater than 95% as determined by SDS-PAGE.
Sequence MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVS ADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLT VHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWS ENDPADFRIYNVTYLEPSLRIAASTLKSGISYRAR VRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Protein Familie Type I cytokine receptor family, Type 4 subfamily
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-4 receptor subunit alpha,IL-4 receptor subunit alpha,IL-4R subunit alpha,IL-4R-alpha,IL-4RA,CD124,IL-4-binding protein,IL4-BP,IL4R,IL4RA
Lieferbar
Manufacturer - Category
Cytokine / Interleukin
Manufacturer - Conjugate / Tag
C-terminal Fc-tagged
Molecular Weight
50.2 kDa
Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
General Research Areas
Immunology
Relevance
Interleukin 4 Receptor alpha (IL4-Ra) is a widely expressed 140 kDa transmembrane glycoprotein in the class I cytokine receptor family. Mature human IL4-Ra consists of a 207 amino acid (aa) extracellular domain (ECD) that contains a cytokine binding region and one fibronectin type III domain, a 24 aa transmembrane segment, and a 569 aa cytoplasmic domain that contains one Box 1 motif and one ITIM motif. IL4-Ra plays an important role in Th2-biased immune responses, alternative macrophage activation, mucosal immunity, allergic inflammation, tumor progression, and atherogenesis. Soluble forms of IL4-Ra, generated by alternate splicing or proteolysis, retain ligand binding properties and inhibit IL-4 bioactivity. IL4-Ra is a component of two distinct receptor complexes and shows species selectivity between human and mouse. It can associate with the common gamma chain (gammac) to form the IL-4 responsive type I receptor in which gammac increases the affinity for IL-4 and enables signaling. It can alternatively associate with IL13-Ra1 to form the type II receptor which is responsive to both IL-4 and IL-13. The use of shared receptor components contributes to the overlapping biological effects of IL-4 and IL-13 as well as other cytokines that utilize gammac.

Expression Region
26-231aa
Function
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Subcellular Location
Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Tissue Specificity
Isoform 1 and isoform 2 are highly expressed in activated T-cells.
Pathway
Jak-STATsignalingpathway
Gene Names
IL4R
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological activity
The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF?1 human erythroleukemic cells is less than 20 ng/ml.
Manufacturer - Format
Lyophilized powder
Protein Description
Extracellular Domain

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen