Vergleich

Recombinant Human R-spondin-1(RSPO1),partial (Active)

ArtNr CSB-AP005721HU-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized powder
Specific against Human (Homo sapiens)
Konjugat/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLE RNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIE HCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSA ANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRR GSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVP CPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR RRKGQQQQQQQGTVGPLTSAGPA
Protein Familie R-spondin family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1
Lieferbar
Manufacturer - Category
Other Recombinant Protein / Others
Manufacturer - Conjugate / Tag
C-terminal 6xHis-tagged
Molecular Weight
26.6 kDa
General Research Areas
Developmental Biology
Relevance
RSPO1 is a secreted protein, containing 2 FU(furin-like) repeats and 1 TSP type-1 domain and belonging to the R-spondin family. RSPO1 is required for the early development of gonads, regardless of sex. It has been found in mice only eleven days after fertilization. To induce cell proliferation, it acts synergistically with WNT4. They help stabilize beta catenin, which activates downstream targets. RSPO1 is necessary in female sex development. It augments the WNT/beta catenin pathway to oppose male sex development. In critical gonadal stages, between six and nine weeks after fertilization, the ovaries upregulate it while the testes downregulate it. RSPO1 can potentially aid in the treatment of mucositis, which is characterized by inflammation of the oral cavity. This unfortunate condition often accompanies chemotherapy and radiation in cancer patients with head and neck tumors.
Function
Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1
Subcellular Location
Secreted, Nucleus
Tissue Specificity
Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen.
Involvement in disease
Keratoderma, palmoplantar, with squamous cell carcinoma of skin and sex reversal (PKKSCC)
Gene Names
RSPO1
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Expression Region
31-263aa
Protein Description
Partial
Biological Activity
The ED50 as determined by its ability to bind Mouse CD36 in functional ELISA is less than 100 ng/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen