Vergleich

Recombinant Human Aldo-keto reductase family 1 member C3(AKR1C3)

ArtNr CSB-EP001544HU-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKAL EVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKK AQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEM ILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALA KKH
Protein Familie Aldo/keto reductase family
Citations "Substrate specificity, gene structure, and tissue-specific distribution of multiple human 3 alpha-hydroxysteroid dehydrogenases."
Khanna M., Qin K.-N., Wang R.W., Cheng K.-C.
J. Biol. Chem. 270:20162-20168(1995)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 17-beta-hydroxysteroid dehydrogenase type 5
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
63.9 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Signal Transduction
Relevance
Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha, 11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.
Expression Region
1-323aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the conversion of aldehydes and ketones to alcohols. Catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ) and the oxidation of 9-alpha, 11-beta-PGF2 to PGD2. Functions as a bi-directional 3-alpha-, 17-beta- and 20-alpha HSD. Can interconvert active androgens, estrogens and progestins with their cognate inactive metabolites. Preferentially transforms androstenedione (4-dione) to testosterone.
Subcellular Location
Cytoplasm
Tissue Specificity
Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels in epithelial cells than in stromal cells. In the brain, expressed in medulla, spinal cord, frontotemporal lobes, thalamus, subthalamic nuclei and amygdala. Weaker expression in the hippocampus, substantia nigra and caudate.
Gene Names
AKR1C3
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 15.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen