« Zurück
Startseite /
Recombinant Human B-cell lymphoma/leukemia 10(BCL10)

Recombinant Human B-cell lymphoma/leukemia 10(BCL10)

ArtNr	CSB-EP002608HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Heart & Blood Cancer Lymphatic System Cancer
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAE RHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLK LRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLP VLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE EEGTCANSSEMFLPLRSRTVSRQ
Citations	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B-cell CLL/lymphoma 10 ,hCLAPCED-3/ICH-1 prodomain homologous E10-like regulator ,CIPER,Cellular homolog of vCARMEN ,cCARMENCellular-E10 ,c-E10Mammalian CARD-containing adapter molecule E10 ,mE10
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Apoptosis
Relevance	Involved in adaptive immune response. Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Is a substrate for MALT1 .
Expression Region	1-233aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in adaptive immune response
Subcellular Location	Cytoplasm, perinuclear region, Membrane raft
Tissue Specificity	Ubiquitous.
Involvement in disease	Immunodeficiency 37 (IMD37); Lymphoma, mucosa-associated lymphoid type (MALTOMA)
Pathway	NF-kappaBsignalingpathway
Gene Names	BCL10
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP002608HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern