Vergleich

Recombinant Human DNA replication licensing factor MCM2(MCM2)

ArtNr CSB-EP013590HU-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTD ALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGEE LIGDGMERDYRAIPELDAYEAEGLALDDEDVEELT ASQREAAERAMRQRDREAGRGLGRMRRGLLYDSDE EDEERPARKRRQVERATEDGEEDEEMIESIENLED LKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHG HNVFKERISDMCKENRESLVVNYEDLAAREHVLAY FLP
Protein Familie MCM family
Citations A human nuclear protein with sequence homology to a family of early S phase proteins is required for entry into S phase and for cell division.Todorov I.T., Pepperkok R., Philipova R.N., Kearsey S.E., Ansorge W., Werner D.J. Cell Sci. 107:253-265(1994)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Minichromosome maintenance protein 2 homologNuclear protein BM28
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
105.8 kDa
General Research Areas
Cell Cycle
Relevance
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division.
Expression Region
2-904aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for the entry in S phase and for cell division. Plays a role in terminally differentiated hair cells development of the cochlea and induces cells apoptosis.
Subcellular Location
Nucleus
Involvement in disease
Deafness, autosomal dominant, 70 (DFNA70)
Paythway
Cellcycle
Gene Names
MCM2
Sequence Info
Full Length of Mature Protein
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen