« Zurück
Home /
Recombinant Human Ribonuclease P protein subunit p29(POP4)

Recombinant Human Ribonuclease P protein subunit p29(POP4)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP018373HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	O95707
Gene Names	POP4
Organism	Homo sapiens (Human)
AA Sequence	MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFL KRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHEL WKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLK VIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK KFKAKGTIDL
Expression Region	1-220aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	41.4 kDa
Relevance	Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assbly of RNase P.
Reference	Rpp14 and Rpp29, two protein subunits of human ribonuclease P.Jarrous N., Eder P.S., Wesolowski D., Altman S.RNA 5:153-157(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
Subcellular Location	Nucleus, nucleolus
Protein Families	Eukaryotic/archaeal RNase P protein component 1 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018373HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen