Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
500ug |
Host |
E.coli |
ArtNr |
CSB-EP018860HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Immunology |
Target / Protein |
PSIP1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O75475 |
AA Sequence |
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKP PTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGK PNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNAS SDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDIT TPKAARRGRKRKAEKQVETEEAGVVTTATASVNLK VSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDI ITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPR KEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGD DQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRK RKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS RLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQV TMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANK TKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQP QHNGESNEDSKDNHEASTKKKPSSEERETEISLKD STLDN |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-530aa |
Protein length |
Full Length |
MW |
76.1 kDa |
Alternative Name(s) |
CLL-associated antigen KW-7Dense fine speckles 70 kDa protein ; DFS 70Lens epithelium-derived growth factorTranscriptional coactivator p75/p52 |
Relevance |
Transcriptional coactivator involved in neuroepithelial st cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration. |
References |
Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.Ge H., Si Y., Roeder R.G.EMBO J. 17:6723-6729(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration. |
Involvement in disease |
A chromosomal aberration involving PSIP1 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9; 11)(p22; p15) with NUP98. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1 exon 4. |
Subcellular Location |
Nucleus |
Protein Families |
HDGF family |
Tissue Specificity |
Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventricular zone (SVZ), in hippocampus, and undetectable elsewhere. In the fetal brain, expressed in the germinal neuroepithelium and cortical plate regions. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.