Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP019131HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Neuroscience |
Target / Protein |
PZP |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P20742 |
AA Sequence |
MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQ GHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLK VFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGV VERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFP ETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFC LSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGE VFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASG ANVSEQLSLKLPSNVVKESARASFSVLGDILGSAM QNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQ QLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
472-821aa |
Protein length |
Partial of Isoform 2 |
MW |
42.3 kDa |
Alternative Name(s) |
C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6 |
Relevance |
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
References |
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
Subcellular Location |
Secreted |
Protein Families |
Protease inhibitor I39 (alpha-2-macroglobulin) family |
Tissue Specificity |
Plasma. Prominent constituent of late-pregnancy sera. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.