« Zurück
Home /
Recombinant Human Ras-related protein Rab-2A(RAB2A)

Recombinant Human Ras-related protein Rab-2A(RAB2A)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP019180HU-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Cancer
Uniprot ID	P61019
Gene Names	RAB2A
Organism	Homo sapiens (Human)
AA Sequence	AYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHD LTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSI TRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQ HSNSNMVIMLIGNKSDLESRREVKKEEGEAFAREH GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF DINNEANGIKIGPQHAATNATHAGNQGGQQAGGGC
Expression Region	2-212aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.4 kDa
Relevance	Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Reference	Nucleotide sequence of a new YPT1-related human cDNA which belongs to the ras gene superfamily.Tachibana K., Umezawa A., Kato S., Takano T.Nucleic Acids Res. 16:10368-10368(1988)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for protein transport from the endoplasmic reticulum to the Golgi complex.
Subcellular Location	Endoplasmic reticulum-Golgi intermediate compartment membrane, Lipid-anchor, Melanosome, Endoplasmic reticulum membrane, Lipid-anchor, Golgi apparatus membrane, Lipid-anchor
Protein Families	Small GTPase superfamily, Rab family
Paythway	AMPKSignaling
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019180HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen