« Zurück
Startseite /
Recombinant Human GMP reductase 1(GMPR)

Recombinant Human GMP reductase 1(GMPR)

ArtNr	CSB-EP339756HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERT FTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGS GQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADI IKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMF SGH
Protein Familie	IMPDH/GMPR family, GuaC type 1 subfamily
Citations	Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase.Kanno H., Huang I.Y., Kan Y.W., Yoshida A.Cell 58:595-606(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Guanosine 5'-monophosphate oxidoreductase 1 ,Guanosine monophosphate reductase 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.4 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cell Biology
Relevance	Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Expression Region	1-345aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Gene Names	GMPR
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP339756HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern