« Zurück
Startseite /
Recombinant Human Anamorsin(CIAPIN1)

Recombinant Human Anamorsin(CIAPIN1)

ArtNr	CSB-EP738750HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQAL TGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG STTLHSAEILAEIARILRPGGCLFLKEPVETAVDN NSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLK LSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKA CKN
Protein Familie	Anamorsin family
Citations	Yang Y., Xu X., Gao G., Xiao H., Chen Z., Han Z. Towards a catalog of human genes and proteins sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokine-induced apoptosis inhibitor 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	49.6 kDa
General Research Areas	Apoptosis
Relevance	Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hatopoietic cells . Component of the cytosolic iron-sulfur (Fe-S) protein assbly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis. Electrons are transferred to the Fe-S cluster from NADPH via the FAD- and FMN-containing protein NDOR1.1 Publication
Expression Region	1-312aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells (By similarity). Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis. Electrons are transferred to the Fe-S cluster from NADPH via the FAD- and FMN-containing protein NDOR1.
Subcellular Location	Cytoplasm, Nucleus, Mitochondrion, Mitochondrion intermembrane space
Tissue Specificity	Ubiquitously expressed. Highly expressed in heart, liver and pancreas.
Gene Names	CIAPIN1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP738750HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern