« Zurück
Startseite /
Recombinant Human Annexin A2(ANXA2)

Recombinant Human Annexin A2(ANXA2)

ArtNr	CSB-RP010654h-1
Hersteller	Cusabio
Menge	1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDA ERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQD IAFAYQRRTKKELASALKSALSGHLETVILGLLKT PAQYDASELKASMKGLGTDEDSLIEIICSRTNQEL QEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALA KGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV PKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIR KEV
Citations	Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.Huang K.-S., Wallner B.P., Mattaliano R.J., Tizard R., Burne C., Frey A., Hession C., McGray P., Sinclair L.K., Chow E.P., Browning J.L., Ramachandran K.L., Tang J., Smart J.E., Pepinsky R.B.Cell 46:191-199(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Annexin IIAnnexin-2;Calpactin I heavy chain;Calpactin-1 heavy chain;Chromobindin-8Lipocortin IIPlacental anticoagulant protein IV ;PAP-IVProtein Ip36
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 65, 6
General Research Areas	Signal Transduction
Relevance	Calcium-regulated mbrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response.
Expression Region	1-339aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	ANXA2
Sequence Info	Full Length
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

nicht lieferbar